Home > Suppliers > Abbiotec > Urocortin III Peptide (Mouse)

View basket (empty)

Urocortin III Peptide (Mouse)

Manufacturer: Abbiotec
Shipping: Cold Gel Packs

Format : Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.

Alternate Names : Urocortin-3; Urocortin III; Ucn III; UCN3

Accession No. : Q924A4

MW : 4173.01 g/mol

Sequence : Mouse: H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 or H-FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Composition : C186H312N52O52S2

Purity : Purity > 95% by HPLC

Solubility : Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.

Storage  : Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.

SizeCatalogue noPrice 
1mg size 350417 £395.00/€553.00
Qty:

All prices shown are exlusive of VAT.